PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA06g04310
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family M-type_MADS
Protein Properties Length: 91aa    MW: 10309.2 Da    PI: 10.2459
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA06g04310genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF44.22.4e-14544544
                SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
      SRF-TF  5 nksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                n+s   +  sk ++ ++KKA+ELS+LC++eva+iifs  g
  CA06g04310  5 NSSVEGIKMSKMQKSLFKKANELSILCGTEVAIIIFSIGG 44
                666666778999************************9765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.9E-4152IPR002100Transcription factor, MADS-box
PROSITE profilePS5006613.119153IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.03E-151277IPR002100Transcription factor, MADS-box
PfamPF003198.7E-131347IPR002100Transcription factor, MADS-box
PRINTSPR004047.0E-71530IPR002100Transcription factor, MADS-box
PRINTSPR004047.0E-73051IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 91 aa     Download sequence    Send to blast
MERKNSSVEG IKMSKMQKSL FKKANELSIL CGTEVAIIIF SIGGQPVLFG KPDVESVVYH  60
FMEAKHPAAL RNYMKMKKKE EEKKGERKIY *
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016578811.15e-30PREDICTED: agamous-like MADS-box protein AGL29
TrEMBLM1DAL35e-29M1DAL3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000859301e-28(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22971258
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.12e-14AGAMOUS-like 29